DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13992 and YRF1-3

DIOPT Version :9

Sequence 1:NP_001188703.1 Gene:CG13992 / 33831 FlyBaseID:FBgn0031756 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_011812.3 Gene:YRF1-3 / 853213 SGDID:S000003528 Length:1859 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:25/107 - (23%)
Similarity:42/107 - (39%) Gaps:16/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   535 NQDAASTSTTEAAPTTEVQSERSGKLNFSSSTPAPPSSEQPDTIVGDDHDSDEA--EDSAEDFDK 597
            |.:.::|:|......|...:..|...|.|::|.|..:|....|.....:.|..|  .:|.....|
Yeast  1399 NSNTSATTTESTDSNTSATTTESTDSNTSATTTASTNSSTNATTTASTNSSTNATTTESTNASAK 1463

  Fly   598 EDDTAMTTPLPASEPDDSADTSGVPAIVSKATELLKPTEKRK 639
            ||         |::..::.|....|     .|::.|.:.|||
Yeast  1464 ED---------ANKDGNAEDNRFHP-----VTDINKESYKRK 1491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13992NP_001188703.1 PLN03142 573..>642 CDD:215601 15/69 (22%)
YRF1-3NP_011812.3 Sir1 41..152 CDD:402962
SrmB 800..1316 CDD:223587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CNHI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.