DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13992 and YRF1-4

DIOPT Version :9

Sequence 1:NP_001188703.1 Gene:CG13992 / 33831 FlyBaseID:FBgn0031756 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_013571.3 Gene:YRF1-4 / 851187 SGDID:S000004458 Length:1382 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:25/107 - (23%)
Similarity:42/107 - (39%) Gaps:16/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   535 NQDAASTSTTEAAPTTEVQSERSGKLNFSSSTPAPPSSEQPDTIVGDDHDSDEA--EDSAEDFDK 597
            |.:.::|:|......|...:..|...|.|::|.|..:|....|.....:.|..|  .:|.....|
Yeast   921 NSNTSATTTESTDSNTSATTTESTDSNTSATTTASTNSSTNATTTASTNSSTNATTTESTNASAK 985

  Fly   598 EDDTAMTTPLPASEPDDSADTSGVPAIVSKATELLKPTEKRK 639
            ||         |::..::.|....|     .|::.|.:.|||
Yeast   986 ED---------ANKDGNAEDNRFHP-----VTDINKESYKRK 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13992NP_001188703.1 PLN03142 573..>642 CDD:215601 15/69 (22%)
YRF1-4NP_013571.3 SrmB 322..811 CDD:223587
P-loop_NTPase 376..549 CDD:304359
HELICc 624..728 CDD:238034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CNHI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.