DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psd and FLO5

DIOPT Version :9

Sequence 1:NP_001260116.1 Gene:psd / 33830 FlyBaseID:FBgn0086265 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_012081.1 Gene:FLO5 / 856618 SGDID:S000001254 Length:1075 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:23/105 - (21%)
Similarity:35/105 - (33%) Gaps:33/105 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 PASSYTQGYSQPAQPSYVGAPPAQIVYQPIIYLSTPLASKSSTSQVEYDDQKYVTPTAPPPPPPP 319
            |.||.|.|.|:....|                    .:|.||:|.:..:..|..|.::...|   
Yeast   714 PTSSSTSGSSESKTSS--------------------ASSSSSSSSISSESPKSPTNSSSSLP--- 755

  Fly   320 APVYEAPSQNCYQPAAPPAPNYAT---------PSCQTPI 350
             ||..|.:......:.|||....|         .||::.:
Yeast   756 -PVTSATTGQETASSLPPATTTKTSEQTTLVTVTSCESHV 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psdNP_001260116.1 None
FLO5NP_012081.1 PA14 100..249 CDD:400161
Flocculin 503..540 CDD:395499
Flocculin_t3 784..825 CDD:404761 2/11 (18%)
Flocculin_t3 859..897 CDD:404761
Flocculin_t3 905..948 CDD:404761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.