DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psd and FLO1

DIOPT Version :9

Sequence 1:NP_001260116.1 Gene:psd / 33830 FlyBaseID:FBgn0086265 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_009424.1 Gene:FLO1 / 851289 SGDID:S000000084 Length:1537 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:54/264 - (20%)
Similarity:78/264 - (29%) Gaps:93/264 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FPTASPCGQCGG----------GCGQNNYVAPAPQSPSYGG---DGYGVLPNG-GYIKPDTEYNG 179
            :.:.:..|..||          .|..::...|.||..|||.   .|.|...|. |.....|:..|
Yeast    64 YASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFG 128

  Fly   180 PGDGDAGYVAPAAPAYEAPAPPAPAYEAPAPPAPAYEAPAPAAPAYEAPAPAAPAYEAPTTDYSA 244
                  .|..|.....|               ...|..|         |...:..::..|.|.||
Yeast   129 ------FYTTPTNVTLE---------------MTGYFLP---------PQTGSYTFKFATVDDSA 163

  Fly   245 --PAPPAPAY------EPPASS--YT------QGYSQPAQPSYVGAP--------PAQIVYQPII 285
              ....|.|:      :||.:|  :|      .|.|.|  |:..|..        |.::||...:
Yeast   164 ILSVGGATAFNCCAQQQPPITSTNFTIDGIKPWGGSLP--PNIEGTVYMYAGYYYPMKVVYSNAV 226

  Fly   286 YLST-PLA-SKSSTSQVEYDDQKYVTPTAPPPPPPPAPVY----EAPSQNCYQPAAPPAPNYATP 344
            ...| |:: :....:.|..|.:.|              ||    :....||   ..|...|||..
Yeast   227 SWGTLPISVTLPDGTTVSDDFEGY--------------VYSFDDDLSQSNC---TVPDPSNYAVS 274

  Fly   345 SCQT 348
            :..|
Yeast   275 TTTT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psdNP_001260116.1 None
FLO1NP_009424.1 PA14 100..249 CDD:284994 37/180 (21%)
Flocculin_t3 1235..1276 CDD:290639
Flocculin_t3 1303..1341 CDD:290639
Flocculin_t3 1349..1392 CDD:290639
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.