DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psd and CG32793

DIOPT Version :9

Sequence 1:NP_001260116.1 Gene:psd / 33830 FlyBaseID:FBgn0086265 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_726835.1 Gene:CG32793 / 31280 FlyBaseID:FBgn0052793 Length:826 Species:Drosophila melanogaster


Alignment Length:176 Identity:39/176 - (22%)
Similarity:63/176 - (35%) Gaps:39/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 AYEAPAPAAPAYEAPAPAAPAYEAPTTDYS----AP-APPAPAYEPP----ASSYTQGYSQPAQP 269
            |:...|..:...||| ....:.|:|..|.:    || ||..|..:||    |:.......:.||.
  Fly    14 AFGHMASVSAVTEAP-EVEQSTESPIADMALIEDAPMAPKTPTEKPPIVQEAAMVVDAQEKSAQV 77

  Fly   270 SYVGAPPAQIVYQPIIYLSTPLASKSSTSQVEYDDQKYVTPTAPPPPPPPAPVYEAPSQNCYQPA 334
            :......|..:..|:|      |.|...:.:|....|..||::..|..|...::.      ..||
  Fly    78 APQPHTVADFIIHPLI------AFKPRQASLEEIQGKQATPSSSAPASPGTWLFG------MNPA 130

  Fly   335 APPAPNYATPSCQTPIRLSLIDQPYRVAPELFEEYNYRLALASQNI 380
            .....:::|                 :|..:...:|.|||.|.|.:
  Fly   131 QQLGSSFST-----------------LAGSVSGWFNDRLAAAGQQL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psdNP_001260116.1 None
CG32793NP_726835.1 RR_TM4-6 <767..>826 CDD:283990
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.