DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psd and CG42676

DIOPT Version :9

Sequence 1:NP_001260116.1 Gene:psd / 33830 FlyBaseID:FBgn0086265 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001286905.1 Gene:CG42676 / 2768999 FlyBaseID:FBgn0261562 Length:427 Species:Drosophila melanogaster


Alignment Length:170 Identity:40/170 - (23%)
Similarity:54/170 - (31%) Gaps:66/170 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GQNNYV---------------APAPQSPSYGGDGYGVLPNGGYIKPDTEYNGPGDGDAGYVAPAA 192
            |.:|||               :|.|:.|                   |....|.:     |..||
  Fly    89 GLDNYVLNRQCRCTDQKMLNDSPTPEEP-------------------TNLCQPSN-----VLEAA 129

  Fly   193 PAYEAPAPPA------PAYEAPAPPAPAY----EAPAPAA-----PAYEAPAPAAPAY----EAP 238
            |......||.      |.:|.....:..|    |:...|:     |||||.:|... |    |.|
  Fly   130 PTPLMSLPPCEDEDHEPEHEHEHEESMKYRIDKESSGAASAELGLPAYEACSPKMD-YDTQDELP 193

  Fly   239 TTDYSAPAPPAP-------AYEPPASSYTQGYSQPAQPSY 271
            .:.:|.|.||.|       ...||.:|:.|...|..|..:
  Fly   194 DSPHSQPLPPPPFPLSTALPLPPPPTSHHQHLQQQQQQQH 233



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.