DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psd and EEED8.14

DIOPT Version :9

Sequence 1:NP_001260116.1 Gene:psd / 33830 FlyBaseID:FBgn0086265 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_495024.2 Gene:EEED8.14 / 184046 WormBaseID:WBGene00017142 Length:353 Species:Caenorhabditis elegans


Alignment Length:51 Identity:11/51 - (21%)
Similarity:22/51 - (43%) Gaps:8/51 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 YQPAAPPAPNYATPSCQTPIRLSLIDQPYRVAPELFEEYNYRLALASQNIL 381
            ||.  ||    ..|.|..  ..||:|:...:..|:......::.|.:::::
 Worm    27 YQD--PP----VDPRCTE--HFSLLDRKVEIISEVQAIQEKKIGLLNESLM 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psdNP_001260116.1 None
EEED8.14NP_495024.2 Smc <41..230 CDD:224117 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM9P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.