powered by:
Protein Alignment psd and EEED8.14
DIOPT Version :9
Sequence 1: | NP_001260116.1 |
Gene: | psd / 33830 |
FlyBaseID: | FBgn0086265 |
Length: | 381 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495024.2 |
Gene: | EEED8.14 / 184046 |
WormBaseID: | WBGene00017142 |
Length: | 353 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 11/51 - (21%) |
Similarity: | 22/51 - (43%) |
Gaps: | 8/51 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 YQPAAPPAPNYATPSCQTPIRLSLIDQPYRVAPELFEEYNYRLALASQNIL 381
||. || ..|.|.. ..||:|:...:..|:......::.|.:::::
Worm 27 YQD--PP----VDPRCTE--HFSLLDRKVEIISEVQAIQEKKIGLLNESLM 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
psd | NP_001260116.1 |
None |
EEED8.14 | NP_495024.2 |
Smc |
<41..230 |
CDD:224117 |
5/29 (17%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CM9P |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.