DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICAM1 and sns

DIOPT Version :9

Sequence 1:NP_000192.2 Gene:ICAM1 / 3383 HGNCID:5344 Length:532 Species:Homo sapiens
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:563 Identity:129/563 - (22%)
Similarity:207/563 - (36%) Gaps:149/563 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKL-------- 57
            ::|..|..|    .|.|..|:| ||........:...|.||.:|.:.|.:....|..        
  Fly   265 LSPDMPMRA----TVQLSVLYP-PGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNG 324

Human    58 ----LGIETPLPKKELLL-----PGNNRKVY--ELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYW 111
                :...|.....|.:.     .|:|:..:  |.|||...: |:          .|:..|:|.:
  Fly   325 SQIRMAYRTSGRLSENIYTFTAEAGDNKARFRCEASNVMSQN-PL----------KAEVELSVLF 378

Human   112 TPERV-----------ELAPL-----PS-------WQPVG---KNLTLRCQV--EGG-APRANLT 147
            .|..|           ::.||     ||       |...|   :|.|.:..|  ||| ...:|:|
  Fly   379 APTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSNIT 443

Human   148 VVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTF 212
                          ||.||.:.:..|:.    ||.|             ::|.||..:.:.:...
  Fly   444 --------------AVVEPNKRSLVVIC----HGLN-------------MQLTENVVSTHTINVL 477

Human   213 VLPATPPQLVS----PRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAK 273
            ..||  |.|:|    .:::...:...::|...|..|:  |.:.....|:|:|..:...:.|.||:
  Fly   478 YPPA--PPLISGYMEGQIIPAGSVQKLLCVSSGGNPL--ATLTWYKNDKRINSVIRAADKSVSAE 538

Human   274 ASVSVTAEDEGTQRLTCAVILGNQSQE--TLQTVTIYSFPAPNVILTKPEVSE---GTEVTVKCE 333
            .::.....|...| ..|..  .|.:.|  ..|:.|:....||..:..:.|..|   |.|.|:.|:
  Fly   539 ITILANVSDNQAQ-YRCEA--SNSATEIPLFQSTTLSVHFAPETVKIRIEPEELRPGMEATIICD 600

Human   334 ---AHPRAKVT--LNGVPAQPLGPRA------------QLLLKATPEDNGRSFSCSATLEVAGQL 381
               ::|.||::  .:|:|.:.:...:            :..:..|.|.||:.::|.:..|...:.
  Fly   601 SSSSNPPAKLSWWKDGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRS 665

Human   382 IHKNQTRELRVLYGPRLDERDCPGNWT--WPENSQQTPMCQAWGNPLP-ELKCLKDGTFPLP--- 440
            .|  :...|.|||.|:...   |.:.|  ..|........|...||.| ..|..|||| .:|   
  Fly   666 AH--EAVSLDVLYRPKFVP---PPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGT-TIPQDG 724

Human   441 ------IGESVTVT---RDLEGTYLCRARSTQGEVTRKVTVNV 474
                  .|.|:..|   ||..|.|.|.|.::||..|..:||.|
  Fly   725 DHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVV 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICAM1NP_000192.2 ICAM_N 24..110 CDD:252248 19/104 (18%)
Ig2_ICAM-1_like 113..207 CDD:143232 27/122 (22%)
Cell attachment site, atypical. /evidence=ECO:0000255 152..154 0/1 (0%)
Ig 311..387 CDD:325142 20/95 (21%)
IG_like 404..474 CDD:214653 27/84 (32%)
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 5/17 (29%)
Ig 197..279 CDD:299845 5/17 (29%)
IG_like 296..376 CDD:214653 17/90 (19%)
Ig 300..361 CDD:299845 9/60 (15%)
Ig 380..454 CDD:299845 20/87 (23%)
IG_like 490..573 CDD:214653 17/87 (20%)
Ig 501..560 CDD:299845 14/63 (22%)
Ig 584..666 CDD:299845 17/81 (21%)
IG_like 585..666 CDD:214653 17/80 (21%)
I-set 678..767 CDD:254352 28/92 (30%)
IGc2 692..757 CDD:197706 20/65 (31%)
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.