DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICAM1 and side-VIII

DIOPT Version :9

Sequence 1:NP_000192.2 Gene:ICAM1 / 3383 HGNCID:5344 Length:532 Species:Homo sapiens
Sequence 2:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster


Alignment Length:652 Identity:130/652 - (19%)
Similarity:212/652 - (32%) Gaps:227/652 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAPSSPRPA-LPALLVLLGALFPGPGNAQTSVSPSK--------------VILPRGGSVL----- 45
            |:.:|.|.. ||..|::|.|| .||..|.:.|..|.              ::|..|..||     
  Fly     1 MSRTSSRSLFLPLCLLVLSAL-NGPAAAASRVRVSSSTTMTRNIEEENALLLLLAGPPVLSESIM 64

Human    46 -----VTCSTSC----DQPKL-----LGIETPL-------------------PKKELL---LPGN 74
                 :.|:.:.    |:..|     :|::||:                   ..:|.|   :.|.
  Fly    65 GTVGRLPCNVTPPIYEDRVALVIWYKVGLKTPIYSVDTRDSNFAQGTHWSDETYRERLSFHVEGR 129

Human    75 NRKVYELSNVQEDS-QPMC---YSNCPDGQSTAKTFLTVYWTPERV-------------ELAPLP 122
            ...:...|..::|: :..|   :...|...|  |..|||...||.|             .|.|..
  Fly   130 AGTLTIKSTTEDDTGEYRCRVDFQKSPTRNS--KVNLTVIIPPESVIILDSKGVTIEDHTLGPYN 192

Human   123 SWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEP---AEVTTTV----LVRRDHH 180
            .    |..:.:.|...||.|:..:|  .|.|....| ..:||:|   ..|..|:    |.||:.|
  Fly   193 E----GSGINITCVAIGGRPQPRVT--WLHGNTVYK-NASVGQPLSERRVGNTLSLARLERRNLH 250

Human   181 GANFSCRTE---------------LDLRP-----QGLELFENTSAPYQLQTFVLPATPPQLVSPR 225
             ...:||.|               ::|||     ||.....:....|||...|:.|.|       
  Fly   251 -MQLTCRAENNNLTTPIISSVVLDMNLRPLIVKLQGENRALSAGNSYQLSCVVIGARP------- 307

Human   226 VLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTC 290
                   ...:....|..|:.... .:|..|..|..:|          .:.:.|.:|.| :.|:|
  Fly   308 -------APTITWWKGSTPMKNTH-EIATPDGNLTTSV----------LTFTPTIDDRG-KFLSC 353

Human   291 AV---ILGNQSQETLQTVTIYSFPAPNVIL----TKPEVSEGTEVTVKC--EAHP---------R 337
            ..   ::.....|....:.||..|..::.|    ....:.||.:|..:|  :::|         .
  Fly   354 RAEQSMIPESGMEDGWKLDIYHIPVVSLELGTNSLNSTLREGIDVFFECNIKSNPWIYEVSWRHN 418

Human   338 AKVTLNGVPAQPLGPRAQ-LLLKATPEDNGRSFSC-SATLEVAGQLIHKNQTRELRVLYGPRLDE 400
            .|:..|. ||:.:....| |:|:.........::| .:..|..|:    :...:|.:.:.|....
  Fly   419 GKILTNN-PAEGIAVSNQSLVLQNASRARSGIYTCVGSNREGDGE----SNPVQLDIRFAPVCRP 478

Human   401 RDCPGNWTWPENSQQT--PMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQ 463
            |.   ..::.....:|  ..|:...||                         .|.||:.:..:||
  Fly   479 RQ---RLSYSSGRHETVKVACEIDANP-------------------------AEATYVWKFNATQ 515

Human   464 GEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQ 528
            ||     ||::  |..::.:                    :|.|.|..|        |||..|..
  Fly   516 GE-----TVDI--PASQVAV--------------------DRGRSIAHY--------TPMTENDY 545

Human   529 AT 530
            .|
  Fly   546 GT 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICAM1NP_000192.2 ICAM_N 24..110 CDD:252248 25/144 (17%)
Ig2_ICAM-1_like 113..207 CDD:143232 31/133 (23%)
Cell attachment site, atypical. /evidence=ECO:0000255 152..154 0/1 (0%)
Ig 311..387 CDD:325142 17/92 (18%)
IG_like 404..474 CDD:214653 13/71 (18%)
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 19/112 (17%)
IG_like 60..166 CDD:214653 16/107 (15%)
Ig 182..266 CDD:299845 23/91 (25%)
Ig 296..373 CDD:299845 18/102 (18%)
IG_like 389..464 CDD:214653 15/79 (19%)
IGc2 394..459 CDD:197706 13/65 (20%)
Ig_3 490..554 CDD:290638 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.