DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vm26Ab and Vm34Ca

DIOPT Version :9

Sequence 1:NP_001285648.1 Gene:Vm26Ab / 33827 FlyBaseID:FBgn0003980 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_476785.1 Gene:Vm34Ca / 34758 FlyBaseID:FBgn0003983 Length:119 Species:Drosophila melanogaster


Alignment Length:114 Identity:67/114 - (58%)
Similarity:72/114 - (63%) Gaps:34/114 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGYG--AAPAAPSYSAPAAPAAQAYSAPAAPAYSAPAAPAYSAPAAPAYSAPAAPAYSAPAAPAY 112
            ||||  ||..||||||||| |.|||:|||||:|:|                              
  Fly    32 GGYGKPAAAPAPSYSAPAA-APQAYAAPAAPSYAA------------------------------ 65

  Fly   113 SAPASIPSPPCPKNYLFSCQPSLQPVPCSAPAQSYGSAGAYSQYVPQYA 161
             ||.|||:|||||||||||||:|.||||||||.|||||||||||.|.||
  Fly    66 -APVSIPAPPCPKNYLFSCQPNLAPVPCSAPAPSYGSAGAYSQYAPVYA 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vm26AbNP_001285648.1 Vitelline_membr 118..154 CDD:287507 31/35 (89%)
Vm34CaNP_476785.1 Vitelline_membr 70..106 CDD:371125 31/35 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009972
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.