DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13999 and TMEM138

DIOPT Version :9

Sequence 1:NP_608972.1 Gene:CG13999 / 33826 FlyBaseID:FBgn0031753 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_006718648.1 Gene:TMEM138 / 51524 HGNCID:26944 Length:177 Species:Homo sapiens


Alignment Length:128 Identity:39/128 - (30%)
Similarity:63/128 - (49%) Gaps:5/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLRRYSWVLLFQFALLGVDLFCNAFGPSLARNRLQTAIILFVTQDALIIAEYLLFTLALHSTCV 67
            |....||.||..||.||..|||.|:|...|.:..: ..::||:.||..::...::..|...:|.|
Human     2 LQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPV-IQLVLFIIQDIAVLFNIIIIFLMFFNTFV 65

  Fly    68 YQVGASHIILRNCKLFMASITIYFLLSASQHFWII-YQYRQPPEEDGHHWPLGLIALSVAQRI 129
            :|.|..:::....|..:....:||.||.|.|.|:: .:::   ..:...|..||..|.|.||:
Human    66 FQAGLVNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWK---NSNSFIWTDGLQMLFVFQRL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13999NP_608972.1 TMEM138 40..161 CDD:291596 24/91 (26%)
TMEM138XP_006718648.1 TMEM138 38..>126 CDD:291596 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155320
Domainoid 1 1.000 63 1.000 Domainoid score I10289
eggNOG 1 0.900 - - E1_29P2U
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9518
Inparanoid 1 1.050 82 1.000 Inparanoid score I5203
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49161
OrthoDB 1 1.010 - - D1480637at2759
OrthoFinder 1 1.000 - - FOG0007060
OrthoInspector 1 1.000 - - oto90992
orthoMCL 1 0.900 - - OOG6_107746
Panther 1 1.100 - - LDO PTHR13306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4049
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.