DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13999 and tmem138

DIOPT Version :9

Sequence 1:NP_608972.1 Gene:CG13999 / 33826 FlyBaseID:FBgn0031753 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001008082.1 Gene:tmem138 / 493444 XenbaseID:XB-GENE-973706 Length:162 Species:Xenopus tropicalis


Alignment Length:157 Identity:56/157 - (35%)
Similarity:82/157 - (52%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YSWVLLFQFALLGVDLFCNAFGPSLARNRLQTAIILFVTQDALIIAEYLLFTLALHSTCVYQVGA 72
            ||.||..||.||..|||.|:|. .|.|:.....::||:.||..|:...::..|.|.:|.|:|.|.
 Frog     7 YSLVLSLQFLLLLFDLFVNSFS-ELLRDPPVNQLVLFILQDVGILFAAIVLFLMLFNTFVFQAGL 70

  Fly    73 SHIILRNCKLFMASI---TIYFLLSASQHFWIIYQYRQPPEEDGHH---WPLGLIALSVAQRIMS 131
            ..::   |:.|..::   .:|..||.|.|.|::..     ...|.:   |..||:||.|.||.::
 Frog    71 VSLL---CQRFQVTVILCAVYIALSISLHVWLMNL-----RWTGANRFVWSDGLLALFVLQRFVA 127

  Fly   132 VFYYYSSKSTALTMADPRFKEEHLDWI 158
            |.|:|..|.|||:|.|.||..:.| |:
 Frog   128 VLYFYYYKRTALSMGDSRFYHDSL-WL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13999NP_608972.1 TMEM138 40..161 CDD:291596 41/125 (33%)
tmem138NP_001008082.1 TMEM138 38..156 CDD:317359 41/125 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9827
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9518
Inparanoid 1 1.050 83 1.000 Inparanoid score I5027
OMA 1 1.010 - - QHG49161
OrthoDB 1 1.010 - - D1480637at2759
OrthoFinder 1 1.000 - - FOG0007060
OrthoInspector 1 1.000 - - oto104778
Panther 1 1.100 - - LDO PTHR13306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4049
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.