DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13999 and Tmem138

DIOPT Version :9

Sequence 1:NP_608972.1 Gene:CG13999 / 33826 FlyBaseID:FBgn0031753 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_942072.2 Gene:Tmem138 / 361728 RGDID:735168 Length:162 Species:Rattus norvegicus


Alignment Length:157 Identity:52/157 - (33%)
Similarity:80/157 - (50%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLRRYSWVLLFQFALLGVDLFCNAFGPSLARNRLQTAIILFVTQDALIIAEYLLFTLALHSTCV 67
            |....||.||..||.||..|||.|:|. .|.|......::||:.||..|:...::..|...:|.|
  Rat     2 LQTSNYSLVLSLQFLLLCYDLFVNSFS-ELLRMAPVIQLVLFIIQDIAILFNIIIIFLMFFNTFV 65

  Fly    68 YQVGASHIILRNCKLFMASITIYFLLSASQHFWII-YQYRQPPEEDGHHWPLGLIALSVAQRIMS 131
            :|.|..:::....|..:...::|..||.|.|.|:: .:::   :.....|..||..|.|.||:.:
  Rat    66 FQAGLVNLLFHKFKGTIILTSVYLALSISLHVWVMNVRWK---DSSSFRWTNGLQTLFVFQRLAA 127

  Fly   132 VFYYYSSKSTALTMADPRFKEEHLDWI 158
            |.|.|..|.||:.:.||||.::.| |:
  Rat   128 VLYCYFYKRTAVRLGDPRFYQDSL-WL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13999NP_608972.1 TMEM138 40..161 CDD:291596 36/120 (30%)
Tmem138NP_942072.2 TMEM138 38..156 CDD:405603 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349201
Domainoid 1 1.000 66 1.000 Domainoid score I9765
eggNOG 1 0.900 - - E1_29P2U
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9518
Inparanoid 1 1.050 83 1.000 Inparanoid score I5097
OMA 1 1.010 - - QHG49161
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007060
OrthoInspector 1 1.000 - - oto98087
orthoMCL 1 0.900 - - OOG6_107746
Panther 1 1.100 - - LDO PTHR13306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.