DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13999 and tmem138

DIOPT Version :9

Sequence 1:NP_608972.1 Gene:CG13999 / 33826 FlyBaseID:FBgn0031753 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_002666816.1 Gene:tmem138 / 100332440 ZFINID:ZDB-GENE-120912-1 Length:162 Species:Danio rerio


Alignment Length:158 Identity:55/158 - (34%)
Similarity:79/158 - (50%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLRRYSWVLLFQFALLGVDLFCNAFGPSLARNRLQTAIILFVTQDALIIAEYLLFTLALHSTCV 67
            |....||.|||.|.|||..|||.|:|. .|.|:.....::||:.||..|:...::..|.:.:|.|
Zfish     2 LQTNNYSLVLLIQLALLTFDLFVNSFS-ELLRSAPVIQLVLFIIQDIGILFNVIIILLMMFNTYV 65

  Fly    68 YQVGASHIILRNCKLFMASITIYFLLSASQHFWIIYQYRQPPEEDGHHWPLGLIALSVAQRIMSV 132
            :|||...::|...:..:....:|..||...|.|::  ..:..|.:...|..||..|.|.|||.:|
Zfish    66 FQVGLVSLLLERFRAMLILSALYLTLSICFHCWVM--NLRWMESNRFVWTDGLQVLFVFQRIAAV 128

  Fly   133 FYYYSSKSTALTMADPRFKEEHLDWIAD 160
            .|||..|.|...:.|||..|:. .|:.|
Zfish   129 LYYYFYKRTTEYLGDPRLYEDS-PWLRD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13999NP_608972.1 TMEM138 40..161 CDD:291596 38/121 (31%)
tmem138XP_002666816.1 TMEM138 38..156 CDD:291596 38/121 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590423
Domainoid 1 1.000 64 1.000 Domainoid score I10173
eggNOG 1 0.900 - - E1_29P2U
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9518
Inparanoid 1 1.050 85 1.000 Inparanoid score I5151
OMA 1 1.010 - - QHG49161
OrthoDB 1 1.010 - - D1480637at2759
OrthoFinder 1 1.000 - - FOG0007060
OrthoInspector 1 1.000 - - oto38782
orthoMCL 1 0.900 - - OOG6_107746
Panther 1 1.100 - - LDO PTHR13306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4049
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.