DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9044 and CG11807

DIOPT Version :9

Sequence 1:NP_001260114.1 Gene:CG9044 / 33825 FlyBaseID:FBgn0031752 Length:1318 Species:Drosophila melanogaster
Sequence 2:NP_001260990.1 Gene:CG11807 / 36683 FlyBaseID:FBgn0033996 Length:491 Species:Drosophila melanogaster


Alignment Length:366 Identity:93/366 - (25%)
Similarity:157/366 - (42%) Gaps:60/366 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITELANLLRQNGDKILSSEFTLTLSGSLLRALNDSFTLIADTEIGTGAGYLQPQSFQ-------- 62
            :.:||.|..::||.:|||:....||...:.|:::..:|.....:..|..|    .|.        
  Fly   123 LQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKY----DFSHVLDFCTQ 183

  Fly    63 ----VVKPINAKSSVFPDLQLVHDFVQKTTLLKLTYFPSEHYFEGAIDIAKFRALRRLEVNKINI 123
                ||.|:...:|...|...|...:.::.::     |:...|    ::..||.|:.|:.:.::.
  Fly   184 LVALVVTPVKDNASYAQDYNTVDVPIDRSNII-----PNRLSF----NLNAFRNLKTLKFSALST 239

  Fly   124 GQVVGIQPLRGQLQHLICVKSLT--------SVDDIITRC-----------------GGDNSNGF 163
            ..:|.|:.|:..|| .|||.:.|        ..|::...|                 |...|||.
  Fly   240 ENIVDIELLKPTLQ-TICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGS 303

  Fly   164 ------VWNELKTADFSYNSLRSVDTALEFAQHLQHLNLRHNKLTSVAAIKWLPHLKTLDLSYNC 222
                  .|.|:...|.:.|.|..:|.::..|..|:.|.|..|::.:|..:..||.|:.|.||.|.
  Fly   304 ALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLAELPQLQLLSLSGNL 368

  Fly   223 LTHLPQFHMEACKRLQLLNISNNYVEELLDVAKLDALYNLDLSDNCLLEHSQLLPLSALMSLIVL 287
            :.....:|: ....|..|.::.|.::.|..:.||.:|.|||||.|.:.|..::..::.|..|..|
  Fly   369 IAECVDWHL-TMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLETL 432

  Fly   288 NLQGNPLACNPKHRQATAQYLHKNSATVKFVLDFEPLTKAE 328
            .|.|||||.:..:|.......|:.:|.:.  ||.||..:.|
  Fly   433 RLTGNPLAGSVDYRSRVLARFHERAAEIS--LDNEPGNQQE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9044NP_001260114.1 LIP1 6..96 CDD:292526 21/101 (21%)
LRR_RI <102..302 CDD:238064 62/230 (27%)
leucine-rich repeat 168..190 CDD:275380 5/21 (24%)
LRR_4 189..229 CDD:289563 12/39 (31%)
LRR_8 190..245 CDD:290566 15/54 (28%)
leucine-rich repeat 191..212 CDD:275380 6/20 (30%)
leucine-rich repeat 213..236 CDD:275380 6/22 (27%)
leucine-rich repeat 237..258 CDD:275380 6/20 (30%)
leucine-rich repeat 259..283 CDD:275380 9/23 (39%)
CG11807NP_001260990.1 PX_IRAS 8..126 CDD:132785 0/2 (0%)
leucine-rich repeat 315..336 CDD:275380 5/20 (25%)
LRR_8 335..414 CDD:290566 26/79 (33%)
leucine-rich repeat 337..381 CDD:275380 13/44 (30%)
LRR_4 381..422 CDD:289563 14/40 (35%)
leucine-rich repeat 382..403 CDD:275380 6/20 (30%)
leucine-rich repeat 404..428 CDD:275380 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452034
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1859
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15454
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3315
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.