DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9044 and SPAC926.06c

DIOPT Version :9

Sequence 1:NP_001260114.1 Gene:CG9044 / 33825 FlyBaseID:FBgn0031752 Length:1318 Species:Drosophila melanogaster
Sequence 2:NP_594367.1 Gene:SPAC926.06c / 2543531 PomBaseID:SPAC926.06c Length:621 Species:Schizosaccharomyces pombe


Alignment Length:511 Identity:105/511 - (20%)
Similarity:179/511 - (35%) Gaps:164/511 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KSSVFPDLQLVHDFVQKTTLLKLTYFP--------SEHYFEGAIDIAKFRALRRLEVNKINIGQV 126
            |..:...|:.::....|...:.|.|.|        .|...:.|:.|..|:.|..||:...:|..:
pombe   137 KQRILAILRYIYSCFTKLPAISLVYNPKTPLISQYEEFPLDTAVPITVFKNLSSLEIRGYDIRSI 201

  Fly   127 VGIQPLRGQLQHLI---C-VKSLTSV------DD------------------------------- 150
            .|...|...|:.||   | :..|:.|      ||                               
pombe   202 FGWDFLSTTLKSLILHHCDLADLSEVLIKLVLDDAELYRFRSSRQTYPQQPNSQPCEQHPAHANL 266

  Fly   151 ----------------------------IITRCGGDNSNGFV----------------------W 165
                                        ::::.|..:|:|..                      |
pombe   267 RRSVSLGSKDYLKSSHPPVHKTLSQSVLVLSKDGNASSSGGTENQSANSSSSLMEKDAILSSSSW 331

  Fly   166 NELKTADFSYNSLRSVDTALEFA-QHLQHLNLRHNKLTSVA-AIKWLPHLKTLDLSYNCLTHLPQ 228
            ::|.....|...|:|:...:..: |.|..|:|..|:||.:. |:..||.|.:|:|:.|.:|....
pombe   332 SQLLYLRCSSCKLKSIPKNVFLSLQSLVSLDLSGNELTEIPYALGELPQLCSLNLASNKITGCRT 396

  Fly   229 FHMEACKRLQLLNISNNYVEELLDVAKLDALYNLDLSDNCL---LEHSQLLPLSALMSLIVLNLQ 290
            |:..:...||:|.:|.|::..|..:..:.:|..||:.||.:   :|..:|:..:        |.:
pombe   397 FYHISLSHLQILVLSRNHLTSLSGLENVPSLEKLDIRDNSITDVVEFRRLVGNT--------NFE 453

  Fly   291 GNPLACNP------KHRQATAQYLHKNSATVKFVLD------FEPLTKAEKALTGSQKWRYISGL 343
            ...|:.||      .:|.....|..:...:...:||      .|.:..:|||   |...|.|| |
pombe   454 EAYLSLNPFTKTYSSYRITIFNYFREYPGSKDIMLDGRGPGMLEKMYLSEKA---SAPERVIS-L 514

  Fly   344 SHRSPRSTSMSINSSSASINTSDGSQFSSFGSQRSVSIRGKNYTLEDNQSMDTSQSSKRISSCKI 408
            :..:.:|.|.:|.|||.....|         ..|.|.:..      .|.::.:..:|...:|..:
pombe   515 NPVNQKSHSPAIKSSSTLRKAS---------KTRIVDLSA------PNSAVFSKNASGGDTSSNV 564

  Fly   409 RTVDIEESSEI--NTDAASVSTPNPRSEYEEEPDNSHLETKKKIETLRLTYGNEWL 462
            ..::...|.||  ||::..|                   .:||||.||...|.||:
pombe   565 SLLNGSASEEIPQNTESGQV-------------------FRKKIEMLRQEAGPEWV 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9044NP_001260114.1 LIP1 6..96 CDD:292526 5/25 (20%)
LRR_RI <102..302 CDD:238064 58/301 (19%)
leucine-rich repeat 168..190 CDD:275380 4/22 (18%)
LRR_4 189..229 CDD:289563 15/40 (38%)
LRR_8 190..245 CDD:290566 19/55 (35%)
leucine-rich repeat 191..212 CDD:275380 8/21 (38%)
leucine-rich repeat 213..236 CDD:275380 6/22 (27%)
leucine-rich repeat 237..258 CDD:275380 6/20 (30%)
leucine-rich repeat 259..283 CDD:275380 7/26 (27%)
SPAC926.06cNP_594367.1 LRR 32..474 CDD:227223 66/344 (19%)
LRR_RI <357..>440 CDD:238064 26/82 (32%)
leucine-rich repeat 358..380 CDD:275380 8/21 (38%)
leucine-rich repeat 381..404 CDD:275380 6/22 (27%)
LRR_4 404..444 CDD:289563 12/39 (31%)
leucine-rich repeat 405..426 CDD:275380 6/20 (30%)
leucine-rich repeat 427..451 CDD:275380 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3315
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.