DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpdh1 and CG34149

DIOPT Version :9

Sequence 1:NP_001260112.1 Gene:Gpdh1 / 33824 FlyBaseID:FBgn0001128 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001036745.1 Gene:CG34149 / 4379861 FlyBaseID:FBgn0083985 Length:305 Species:Drosophila melanogaster


Alignment Length:81 Identity:19/81 - (23%)
Similarity:30/81 - (37%) Gaps:11/81 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AKIVGANAAALPEF---EERVTMFVYEELIDGKKLTEIINETHENVKYLKGHKLPPNVVAVPDLV 81
            |.:.....||:.||   ::|...:...:|:    :.|.:.|.||.........:|...:|...|.
  Fly    97 ALLTKGEGAAVQEFRIRQQRSKYYHQRKLV----VMEPLAENHELEPPSTPEPMPVMAIADQSLC 157

  Fly    82 EAAKNADILIFVVPHQ 97
            .||...    ..||.|
  Fly   158 SAASEK----VTVPKQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpdh1NP_001260112.1 glycerol3P_DH 6..343 CDD:274551 19/81 (23%)
CG34149NP_001036745.1 BESS 243..275 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11728
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.