DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpdh1 and Su(var)3-7

DIOPT Version :9

Sequence 1:NP_001260112.1 Gene:Gpdh1 / 33824 FlyBaseID:FBgn0001128 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_524342.3 Gene:Su(var)3-7 / 41627 FlyBaseID:FBgn0003598 Length:1250 Species:Drosophila melanogaster


Alignment Length:113 Identity:26/113 - (23%)
Similarity:37/113 - (32%) Gaps:34/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 VCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRFVDVFYPGSKLSTFFESCGVADLITT 265
            :|....|:     .||...|..:.||      |.||.:|.:|......|                
  Fly   321 ICSVRMNV-----EFVYLRKRHETTK------GHMEALRNLDSDKRSRK---------------- 358

  Fly   266 CYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQGPPTAEEVNYMLKN 313
                |.|..|.:...||....|.|||   .:...||..|::...::.|
  Fly   359 ----RKRSKSNSVTNSGGDEAEREKE---SEPEVGPEDAQDTPVVMMN 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpdh1NP_001260112.1 glycerol3P_DH 6..343 CDD:274551 26/113 (23%)
Su(var)3-7NP_524342.3 BESS 991..1021 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11728
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.