DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and NR1H4

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001193922.1 Gene:NR1H4 / 9971 HGNCID:7967 Length:486 Species:Homo sapiens


Alignment Length:83 Identity:38/83 - (45%)
Similarity:51/83 - (61%) Gaps:5/83 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTAGDRLL-DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKT 64
            ||.:..|:. |..|.|||||:||.||...:|:||.|||:|||.:|.:|.||..|:    |.:|..
Human   124 MGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGN----CVMDMY 184

  Fly    65 HRNQCRACRLAKCFQSAM 82
            .|.:|:.|||.||.:..|
Human   185 MRRKCQECRLRKCKEMGM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 36/79 (46%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
NR1H4NP_001193922.1 NR_DBD_FXR 134..221 CDD:143520 35/73 (48%)
NR_LBD_Fxr 261..481 CDD:132734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.