DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and NR1I3

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_005245750.1 Gene:NR1I3 / 9970 HGNCID:7969 Length:429 Species:Homo sapiens


Alignment Length:416 Identity:87/416 - (20%)
Similarity:137/416 - (32%) Gaps:142/416 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 SPAPTLTTS----SGSPQHRQMSRHSLSEATTPPS------HAS--------LMICASNNNNNNN 412
            ||:|..|..    :|...|..:...|...|.||.|      |..        |.:...|:|:...
Human    10 SPSPCATNQHFCHAGKTSHPGLCPESRVCALTPQSLRATGGHIKQTSLVFQILRVIIPNSNHWQL 74

  Fly   413 NNNNNGEHKQSSYTSGSPTPTT-PTPP--PPRS------GVGSTCNTASSSSGFLELLLSPDKCQ 468
            ..:...:.::.|...|.|.... |...  |.||      .:|.||..|.|             | 
Human    75 LRSEENQQQRGSLGRGIPYQILWPAGDMLPKRSRRTVSKSIGPTCPFAGS-------------C- 125

  Fly   469 ELIQYQVQHNTLLFPQQLLDS-----RLLSWEML------------QETTARL------------ 504
            |:.:.|.:|......|:.||:     .:||.|.|            |:|..:|            
Human   126 EVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLL 190

  Fly   505 ----------------------LFM----------------------------AVRWVKCLMPFQ 519
                                  ||:                            .:::.|.|..|:
Human   191 GAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFR 255

  Fly   520 TLSKNDQHLLLQESWKEL--FLLNLAQWTIPLDLTPILESPLIRERVLQDEATQTEMKTIQ---- 578
            :|...||..||:.:..|:  .:||.   |..|.....|..||  ...::|.|..:.....|    
Human   256 SLPIEDQISLLKGAAVEICHIVLNT---TFCLQTQNFLCGPL--RYTIEDGARVSPTVGFQVEFL 315

  Fly   579 EILCRF----RQITPDGSEVGCMKAIALFAP-----ETAGLCDVQPVEMLQDQAQCILSDHVR-- 632
            |:|..|    |::.....|...:.|:|||:|     :..|:.....::.||::....|..:::  
Human   316 ELLFHFHGTLRKLQLQEPEYVLLAAMALFSPAPYLTDRPGVTQRDEIDQLQEEMALTLQSYIKGQ 380

  Fly   633 LRYPRQATRFGRLLLLLPSLRTIRAA 658
            .|.||....:.:||.||..||:|..|
Human   381 QRRPRDRFLYAKLLGLLAELRSINEA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537
NR_LBD_Tlx_PNR_like 467..671 CDD:132748 60/288 (21%)
NR1I3XP_005245750.1 NR_DBD_like <108..154 CDD:295381 12/59 (20%)
NR_LBD_PXR_like 178..427 CDD:132732 47/234 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.