DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and NR0B2

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_068804.1 Gene:NR0B2 / 8431 HGNCID:7961 Length:257 Species:Homo sapiens


Alignment Length:264 Identity:71/264 - (26%)
Similarity:108/264 - (40%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 CNTASSSSGFLELLLSP---------DKC----QELIQYQVQHNTLLFPQQLLDSRLLSWEMLQE 499
            |..|:|....|..|||.         .:|    ...:|....|.|.   ::.||           
Human    11 CQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTC---REALD----------- 61

  Fly   500 TTARLLFMAVRWVKCLMPFQTLSKNDQHLLLQESWKELFLLNLAQWTIPLDL--TPILESPLIRE 562
                :|...|.:::.|..|..|...||..|||..|..||||.|||..:..::  .|:   |.|.:
Human    62 ----VLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPV---PSILK 119

  Fly   563 RVLQDEAT------------QTEMKTIQEILC---RFRQITPDGSEVGCMKAIALFAPETAGLCD 612
            ::|.:|.:            |..:..:|.:.|   .|..:.....|..|:|...||.|:..||..
Human   120 KILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQA 184

  Fly   613 VQPVEMLQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRTIRAATIEALFFKETIGNVPIARL 677
            ...:..||.:|..:|.:.:....|....|..|:||...:|::|..:.:..|||:..||:|.||.|
Human   185 ASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGL 249

  Fly   678 LRDM 681
            |.||
Human   250 LGDM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537
NR_LBD_Tlx_PNR_like 467..671 CDD:132748 56/224 (25%)
NR0B2NP_068804.1 NR_LBD_SHP 32..254 CDD:132763 64/243 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.