DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and nr0b2b

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001373272.1 Gene:nr0b2b / 797815 ZFINID:ZDB-GENE-080403-9 Length:247 Species:Danio rerio


Alignment Length:191 Identity:39/191 - (20%)
Similarity:89/191 - (46%) Gaps:14/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 RLLFMAVRWVKCLMPFQTLSKNDQHLLLQESWKELFLLNLAQWTIPLDLTPILESPLIRERVLQD 567
            ::|..::.:::..:..|.||.:::..|||:.|..||:|.|||..|..::.......::|..:|..
Zfish    52 QVLTKSIHFMQSSLSHQNLSSSERLCLLQKRWVPLFILGLAQENISFEVMDFPVGSILRNILLSG 116

  Fly   568 E-------ATQTEMKTIQEILCRFRQITPDGSEVGCMKAIALFAP--ETAGLCDVQPVEMLQDQA 623
            :       .|..::..::..|.:...:.....|..|:|...||:.  ::.||.....:..||::.
Zfish   117 QQKPDDCPLTLAKVNKLKMFLDKVWSLQLSLKEYACLKGAILFSQVLDSPGLKSSLVIAGLQEEF 181

  Fly   624 QCILSDHVRLRYPRQATRFGRLLLLLPSLRTIR---AATIEALFFKETIGNVPIARLLRDM 681
            ...|  |:.:...:::.....::.:|.:..|::   .:.:..|||:..:|.:.|..||.::
Zfish   182 AHDL--HMLILSRQRSEEHWTIMDVLFTACTLQMEARSMVTELFFRPIMGKMDIQELLNEI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537
NR_LBD_Tlx_PNR_like 467..671 CDD:132748 35/179 (20%)
nr0b2bNP_001373272.1 NR_LBD 27..241 CDD:416257 39/191 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.