powered by:
Protein Alignment dsf and THRB
DIOPT Version :9
Sequence 1: | NP_001260109.1 |
Gene: | dsf / 33823 |
FlyBaseID: | FBgn0015381 |
Length: | 691 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_000452.2 |
Gene: | THRB / 7068 |
HGNCID: | 11799 |
Length: | 461 |
Species: | Homo sapiens |
Alignment Length: | 136 |
Identity: | 42/136 - (30%) |
Similarity: | 61/136 - (44%) |
Gaps: | 35/136 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRN--RIYTCKATGDLKGRCPVDKTHRNQCRACRLA 75
|.||||:::|.||...:|:||.|||:|:|.:| ..|:|| .:|:|.:||..||||:.||..
Human 107 CVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCK----YEGKCVIDKVTRNQCQECRFK 167
Fly 76 KCFQSAMNKDAV--------------QHERGPRKPKLHPQLHHH---------------HHHAAA 111
||....|..|.| ::....|:.:|...:.|. ..|.|.
Human 168 KCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVAT 232
Fly 112 AAAAAH 117
.|..:|
Human 233 NAQGSH 238
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.