DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dsf and THRB

DIOPT Version :9

Sequence 1:	NP_001260109.1	Gene:	dsf / 33823	FlyBaseID:	FBgn0015381	Length:	691	Species:	Drosophila melanogaster
Sequence 2:	NP_000452.2	Gene:	THRB / 7068	HGNCID:	11799	Length:	461	Species:	Homo sapiens

Alignment Length:	136	Identity:	42/136 - (30%)
Similarity:	61/136 - (44%)	Gaps:	35/136 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRN--RIYTCKATGDLKGRCPVDKTHRNQCRACRLA 75
            |.||||:::|.||...:|:||.|||:|:|.:|  ..|:||    .:|:|.:||..||||:.||..
Human   107 CVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCK----YEGKCVIDKVTRNQCQECRFK 167

  Fly    76 KCFQSAMNKDAV--------------QHERGPRKPKLHPQLHHH---------------HHHAAA 111
            ||....|..|.|              ::....|:.:|...:.|.               ..|.|.
Human   168 KCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVAT 232

  Fly   112 AAAAAH 117
            .|..:|
Human   233 NAQGSH 238

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dsf	NP_001260109.1	NR_DBD_TLX	5..98	CDD:143537	36/100 (36%)
dsf	NP_001260109.1	NR_LBD_Tlx_PNR_like	467..671	CDD:132748
THRB	NP_000452.2	Modulating	1..106
		NR_DBD_TR	106..192	CDD:143519	35/88 (40%)
		NR_LBD_TR	216..458	CDD:132733	4/23 (17%)
		Interaction with NR2F6. /evidence=ECO:0000269\|PubMed:10713182	244..461
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910