DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and NR2F2

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_066285.1 Gene:NR2F2 / 7026 HGNCID:7976 Length:414 Species:Homo sapiens


Alignment Length:677 Identity:149/677 - (22%)
Similarity:207/677 - (30%) Gaps:360/677 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLA 75
            |.|.||||:|||||||.::|:||..|||||:.||..|||:|..:    ||:|:.|||||:.|||.
Human    77 IECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN----CPIDQHHRNQCQYCRLK 137

  Fly    76 KCFQSAMNKDAVQHERGPRKPKLHPQLHHHHHHAAAAAAAAHHAAAAHHHHHHHHHAHAAAAHHA 140
            ||.:..|.::||                                                     
Human   138 KCLKVGMRREAV----------------------------------------------------- 149

  Fly   141 AVAAAAASGLHHHHHAMPVSLVTNVSASFNYTQHISTHPPAPAAPPSGFHLTASGAQQGPAPPAG 205
                                                                    |:|..||. 
Human   150 --------------------------------------------------------QRGRMPPT- 157

  Fly   206 HLHHGGAGHQHATAFHHPGHGHALPAPHGGVVSNPGGNSSAISGSGPGSTLPFPSHLLHHNLIAE 270
                            .|.||                                            
Human   158 ----------------QPTHG-------------------------------------------- 162

  Fly   271 AASKLPGITATAVAAVVSSTSTPYASAAQTSSPSSNNHNYSSPSPSNSIQSISSIGSRSGGGEEG 335
                                     ..|.|:....|.|:|.|                       
Human   163 -------------------------QFALTNGDPLNCHSYLS----------------------- 179

  Fly   336 LSLGSESPRVNVETETPSPSNSPPLSAGSISPAPTLTTSSGSPQHRQMSRHSLSEATTPPSHASL 400
                                                                        .:.||
Human   180 ------------------------------------------------------------GYISL 184

  Fly   401 MICASNNNNNNNNNNNNGEHKQSSYTSGSPTPTTPTPPPPRSGVGSTCNTASSSSGFLELLLSPD 465
            ::.|.                                |.|.|..||.|             :.| 
Human   185 LLRAE--------------------------------PYPTSRFGSQC-------------MQP- 203

  Fly   466 KCQELIQYQVQHNTLLFPQQLLDSRLLSWEMLQETTARLLFMAVRWVKCLMPFQTLSKNDQHLLL 530
                                   :.::..|.:.|..||:||.||.|.:.:..|..|...||..||
Human   204 -----------------------NNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALL 245

  Fly   531 QESWKELFLLNLAQWTIPLDLTPIL------ESPLIRERVLQDEATQTEMKTIQEILCRFRQITP 589
            :.:|.|||:||.||.::||.:.|:|      .||:..:||:   |....::..||.:.:.:.:..
Human   246 RLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVV---AFMDHIRIFQEQVEKLKALHV 307

  Fly   590 DGSEVGCMKAIALFAPETAGLCDVQPVEMLQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRT 654
            |.:|..|:|||.||..:..||.||..||.||:::||.|.::||.:||.|.||||:|||.||||||
Human   308 DSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRT 372

  Fly   655 IRAATIEALFFKETIGNVPIARLLRDM 681
            :.::.||.|||...:|..||..|:|||
Human   373 VSSSVIEQLFFVRLVGKTPIETLIRDM 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 43/86 (50%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748 76/209 (36%)
NR2F2NP_066285.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
NR_DBD_COUP_TF 79..151 CDD:143516 42/184 (23%)
Interaction with ZFPM2. /evidence=ECO:0000250 117..414 123/637 (19%)
NR_LBD_COUP-TF 177..411 CDD:132746 95/378 (25%)
Important for dimerization 337..414 35/63 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.