DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dsf and PGR

DIOPT Version :9

Sequence 1:	NP_001260109.1	Gene:	dsf / 33823	FlyBaseID:	FBgn0015381	Length:	691	Species:	Drosophila melanogaster
Sequence 2:	NP_000917.3	Gene:	PGR / 5241	HGNCID:	8910	Length:	933	Species:	Homo sapiens

Alignment Length:	70	Identity:	32/70 - (45%)
Similarity:	39/70 - (55%)	Gaps:	4/70 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
            |.:|||.:||.|||:.:|..|..||||::.....|.|....|    |.|||..|..|.||||.||
Human   567 CLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRND----CIVDKIRRKNCPACRLRKC 627

  Fly    78 FQSAM 82
            .|:.|
Human   628 CQAGM 632

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dsf	NP_001260109.1	NR_DBD_TLX	5..98	CDD:143537	32/70 (46%)
dsf	NP_001260109.1	NR_LBD_Tlx_PNR_like	467..671	CDD:132748
PGR	NP_000917.3	Modulating, Pro-Rich	1..566
		Prog_receptor	1..564	CDD:280346
		AF3, mediates transcriptional activation (in isoform B). /evidence=ECO:0000269\|PubMed:11546784	1..164
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..157
		LXXL motif 1. /evidence=ECO:0000305\|PubMed:11546784	55..59
		LXXL motif 2. /evidence=ECO:0000305\|PubMed:11546784	115..119
		Mediates transcriptional transrepression (in isoform A). /evidence=ECO:0000269\|PubMed:9407067	165..305
		Nuclear localization signal. /evidence=ECO:0000255	183..187
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	195..241
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	331..351
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	415..452
		AF1, mediates transcriptional activation. /evidence=ECO:0000269\|PubMed:1587864	456..546
		NR_DBD_GR_PR	563..640	CDD:143546	32/70 (46%)
		NR_LBD_PR	686..933	CDD:132759
		AF2, mediates transcriptional activation. /evidence=ECO:0000269\|PubMed:1587864	687..933
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910