DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and Hr83

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster


Alignment Length:115 Identity:55/115 - (47%)
Similarity:65/115 - (56%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
            |.||||:|||||||:..|||||.|||||:.|...|.|.|   |.|.|.|||..||.|.:||..:|
  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIA---LVGNCVVDKARRNWCPSCRFQRC 68

  Fly    78 FQSAMNKDAVQHERGPRKPKLHPQLHHHHHHAA----AAAAAAHHAAAAH 123
            ....||..|||.|||||..::  .|:......|    ||.:...|:.|.|
  Fly    69 LAVGMNAAAVQEERGPRNQQV--ALYRTGRRQAPPSQAAPSPTPHSQALH 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 48/84 (57%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 48/83 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.