DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dsf and AR

DIOPT Version :9

Sequence 1:	NP_001260109.1	Gene:	dsf / 33823	FlyBaseID:	FBgn0015381	Length:	691	Species:	Drosophila melanogaster
Sequence 2:	NP_000035.2	Gene:	AR / 367	HGNCID:	644	Length:	920	Species:	Homo sapiens

Alignment Length:	103	Identity:	38/103 - (36%)
Similarity:	50/103 - (48%)	Gaps:	19/103 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 TAGDRLLDI--------PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRC 59
            ||.|.:|.|        .|.:|||.:||.|||..:|..|..||||:....:.|.|.:..|    |
Human   542 TARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRND----C 602

  Fly    60 PVDKTHRNQCRACRLAKCFQSAMNKDAVQHERGPRKPK 97
            .:||..|..|.:|||.||:::.|.       .|.||.|
Human   603 TIDKFRRKNCPSCRLRKCYEAGMT-------LGARKLK 633

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dsf	NP_001260109.1	NR_DBD_TLX	5..98	CDD:143537	36/101 (36%)
dsf	NP_001260109.1	NR_LBD_Tlx_PNR_like	467..671	CDD:132748
AR	NP_000035.2	Interaction with ZNF318. /evidence=ECO:0000250\|UniProtKB:P19091	1..587		19/44 (43%)
		Modulating	1..559		5/16 (31%)
		Androgen_recep	6..449	CDD:280349
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	36..167
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	195..228
		Interaction with LPXN. /evidence=ECO:0000269\|PubMed:18451096	552..919		33/93 (35%)
		NR_DBD_AR	555..636	CDD:143547	33/90 (37%)
		Interaction with HIPK3. /evidence=ECO:0000250\|UniProtKB:P15207	572..662		26/73 (36%)
		Interaction with CCAR1. /evidence=ECO:0000269\|PubMed:23887938	592..919		18/53 (34%)
		Interaction with KAT7. /evidence=ECO:0000269\|PubMed:10930412	625..919		5/16 (31%)
		NR_LBD_AR	673..918	CDD:132758
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910