DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dsf and AgaP_AGAP012921

DIOPT Version :9

Sequence 1:	NP_001260109.1	Gene:	dsf / 33823	FlyBaseID:	FBgn0015381	Length:	691	Species:	Drosophila melanogaster
Sequence 2:	XP_561285.1	Gene:	AgaP_AGAP012921 / 3292605	VectorBaseID:	AGAP012921	Length:	96	Species:	Anopheles gambiae

Alignment Length:	68	Identity:	56/68 - (82%)
Similarity:	61/68 - (89%)	Gaps:	0/68 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   618 MLQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRTIRAATIEALFFKETIGNVPIARLLRDMY 682
            ||||||||:||:|||:|||||.|||||||||||.|||||:.|||.||||||||.|||:|||.|||
Mosquito     1 MLQDQAQCVLSEHVRVRYPRQPTRFGRLLLLLPLLRTIRSTTIETLFFKETIGTVPISRLLIDMY 65

  Fly   683 TME 685
            .||
Mosquito    66 QME 68

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dsf	NP_001260109.1	NR_DBD_TLX	5..98	CDD:143537
dsf	NP_001260109.1	NR_LBD_Tlx_PNR_like	467..671	CDD:132748	44/52 (85%)
AgaP_AGAP012921	XP_561285.1	NR_LBD	<1..53	CDD:299703	43/51 (84%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E33208_3BC6Q
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D34630at7147
OrthoFinder	1	1.000	-	-		FOG0016853
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.820