DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and Esr2

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_006240283.1 Gene:Esr2 / 25149 RGDID:2582 Length:567 Species:Rattus norvegicus


Alignment Length:79 Identity:38/79 - (48%)
Similarity:49/79 - (62%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
            |.||.|.:||.|||::||:||..||||||..:..|.|.||    .:|.:||..|..|:||||.||
  Rat   168 CAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPAT----NQCTIDKNRRKSCQACRLRKC 228

  Fly    78 FQSAMNKDAVQHER 91
            ::..|.|...:.||
  Rat   229 YEVGMVKCGSRRER 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 38/79 (48%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
Esr2XP_006240283.1 ERbeta_N 35..141 CDD:289279
NR_DBD_ER 163..244 CDD:143545 38/79 (48%)
NR_LBD_ER 282..535 CDD:132747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.