DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and Esr1

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_017444286.2 Gene:Esr1 / 24890 RGDID:2581 Length:665 Species:Rattus norvegicus


Alignment Length:79 Identity:37/79 - (46%)
Similarity:50/79 - (63%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
            |.||.|.:||.|||::||:||..||||||..:..|.|.||    .:|.:||..|..|:||||.||
  Rat   223 CAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPAT----NQCTIDKNRRKSCQACRLRKC 283

  Fly    78 FQSAMNKDAVQHER 91
            ::..|.|..::.:|
  Rat   284 YEVGMMKGGIRKDR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 37/79 (47%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
Esr1XP_017444286.2 Oest_recep 75..219 CDD:396642
NR_DBD_ER 218..299 CDD:143545 37/79 (47%)
NR_LBD_ER 348..617 CDD:132747
ESR1_C 626..665 CDD:403830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.