DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and Nr0b2

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_035980.1 Gene:Nr0b2 / 23957 MGIID:1346344 Length:260 Species:Mus musculus


Alignment Length:258 Identity:70/258 - (27%)
Similarity:108/258 - (41%) Gaps:23/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 RSGVGSTCNTASSSSGFLELLLSPDKCQELIQYQVQHNTLLFPQQLLDSRLLSWEMLQETTARLL 505
            :||| ..|..::.....|..||||......:. ...|:..|..|| ...||.:..........:|
Mouse     5 QSGV-CPCQGSAGRPTILYALLSPSPRTRPVA-PASHSHCLCQQQ-RPVRLCAPHRTCREALDVL 66

  Fly   506 FMAVRWVKCLMPFQTLSKNDQHLLLQESWKELFLLNLAQWTIPLDL--TPILESPLIRERVLQDE 568
            ...|.:::.|..|..|...||..||:..|..||||.|||..:..::  .|:   |.|.:::|.:|
Mouse    67 AKTVAFLRNLPSFCHLPHEDQRRLLECCWGPLFLLGLAQDAVTFEVAEAPV---PSILKKILLEE 128

  Fly   569 ATQ---------------TEMKTIQEILCRFRQITPDGSEVGCMKAIALFAPETAGLCDVQPVEM 618
            |:.               ..::.:|..|..|..:.....|...:|...||.|:..||.....:..
Mouse   129 ASSGTQGAQPSDRPQPSLAAVQWLQRCLESFWSLELGPKEYAYLKGTILFNPDVPGLRASCHIAH 193

  Fly   619 LQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRTIRAATIEALFFKETIGNVPIARLLRDM 681
            ||.:|...|.:.:...||....|..|:||:..:|:.|....:..|||:..:|:|.|..||.||
Mouse   194 LQQEAHWALCEVLEPWYPASQGRLARILLMASTLKNIPGTLLVDLFFRPIMGDVDITELLEDM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537
NR_LBD_Tlx_PNR_like 467..671 CDD:132748 54/220 (25%)
Nr0b2NP_035980.1 NR_LBD 36..257 CDD:299703 61/225 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.