DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dsf and ESR1

DIOPT Version :9

Sequence 1:	NP_001260109.1	Gene:	dsf / 33823	FlyBaseID:	FBgn0015381	Length:	691	Species:	Drosophila melanogaster
Sequence 2:	NP_001278159.1	Gene:	ESR1 / 2099	HGNCID:	3467	Length:	597	Species:	Homo sapiens

Alignment Length:	81	Identity:	39/81 - (48%)
Similarity:	51/81 - (62%)	Gaps:	6/81 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNR--IYTCKATGDLKGRCPVDKTHRNQCRACRLA 75
            |.||.|.:||.|||::||:||..||||||..||  .|.|.||    .:|.:||..|..|:||||.
Human   185 CAVCNDYASGYHYGVWSCEGCKAFFKRSIQGNRHNDYMCPAT----NQCTIDKNRRKSCQACRLR 245

  Fly    76 KCFQSAMNKDAVQHER 91
            ||::..|.|..::.:|
Human   246 KCYEVGMMKGGIRKDR 261

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dsf	NP_001260109.1	NR_DBD_TLX	5..98	CDD:143537	39/81 (48%)
dsf	NP_001260109.1	NR_LBD_Tlx_PNR_like	467..671	CDD:132748
ESR1	NP_001278159.1	Modulating (transactivation AF-1), mediates interaction with MACROD1. /evidence=ECO:0000269\|PubMed:17914104	1..184
		Interaction with DDX5, self-association. /evidence=ECO:0000269\|PubMed:11682626	35..174
		Required for interaction with NCOA1. /evidence=ECO:0000269\|PubMed:11682626	35..47
		Oest_recep	42..181	CDD:280344
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	147..174
		NR_DBD_ER	180..263	CDD:143545	39/81 (48%)
		Hinge	253..312		2/9 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	261..284		1/1 (100%)
		Interaction with AKAP13. /evidence=ECO:0000269\|PubMed:9627117	264..597
		Self-association	266..597
		NR_LBD_ER	312..549	CDD:132747
		Transactivation AF-2	313..597
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	555..575
		ESR1_C	558..597	CDD:289512
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910