DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and nhr-111

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_507060.2 Gene:nhr-111 / 185757 WormBaseID:WBGene00003701 Length:311 Species:Caenorhabditis elegans


Alignment Length:116 Identity:46/116 - (39%)
Similarity:63/116 - (54%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
            |.||||.|:|.|||:.:|.||||||:|::....::.| ..||  |.|.:||.:||:|::||:.||
 Worm    42 CAVCGDTSNGNHYGVPTCFGCSGFFRRTVRNKLVHGC-WNGD--GNCVIDKANRNRCKSCRIKKC 103

  Fly    78 FQSAMNKDAVQHERGPRK-------------------PKLHPQLHHHHHHA 109
            |:..|||:|||.||....                   |....:|...|.||
 Worm   104 FKKGMNKNAVQPERTSHSYTVEYVELPSFREYSKGLLPTHSDRLRFQHEHA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 42/103 (41%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
nhr-111NP_507060.2 NR_DBD_like 42..114 CDD:143512 37/74 (50%)
Glycosyltransferase_GTB_type 115..>256 CDD:299143 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24083
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.