Sequence 1: | NP_001260109.1 | Gene: | dsf / 33823 | FlyBaseID: | FBgn0015381 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001317747.1 | Gene: | nhr-118 / 184398 | WormBaseID: | WBGene00003708 | Length: | 363 | Species: | Caenorhabditis elegans |
Alignment Length: | 83 | Identity: | 38/83 - (45%) |
---|---|---|---|
Similarity: | 54/83 - (65%) | Gaps: | 4/83 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
Fly 78 FQSAMNKDAVQHERGPRK 95 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dsf | NP_001260109.1 | NR_DBD_TLX | 5..98 | CDD:143537 | 38/83 (46%) |
NR_LBD_Tlx_PNR_like | 467..671 | CDD:132748 | |||
nhr-118 | NP_001317747.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |