DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and fax-1

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_508547.1 Gene:fax-1 / 180609 WormBaseID:WBGene00001400 Length:419 Species:Caenorhabditis elegans


Alignment Length:112 Identity:62/112 - (55%)
Similarity:71/112 - (63%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
            |.||||.||||||||.:|:|||||||||:.|..||.|:|.   .|.|.|||.|||||:||||.||
 Worm   102 CAVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQAG---TGNCVVDKAHRNQCQACRLKKC 163

  Fly    78 FQSAMNKDAVQHERGPR-----KPKL--HPQLHHHHHHAAAAAAAAH 117
            ....|||||||:||.||     :|.|  .||.....:..|.:|...|
 Worm   164 LNKGMNKDAVQNERQPRNTATIRPALDMDPQNFFREYAGAVSAIMGH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 56/89 (63%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
fax-1NP_508547.1 NR_DBD_PNR 94..185 CDD:143528 55/85 (65%)
NR_LBD 243..>320 CDD:386099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.