DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and nhr-116

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_507273.2 Gene:nhr-116 / 180129 WormBaseID:WBGene00003706 Length:448 Species:Caenorhabditis elegans


Alignment Length:79 Identity:31/79 - (39%)
Similarity:42/79 - (53%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRN---QCRACRL 74
            |.|||..:.|.||.:.||:||..||:|.....|.::||...|    | .|.|.|.   :||||||
 Worm    50 CLVCGRSAHGYHYNVASCNGCKTFFRRMCLSGRSFSCKLDRD----C-FDLTKRKTPAKCRACRL 109

  Fly    75 AKCFQSAMNKDAVQ 88
            .:|....|:..|::
 Worm   110 QRCLSVGMDPGAME 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 31/79 (39%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
nhr-116NP_507273.2 ZnF_C4 50..119 CDD:197701 30/73 (41%)
HOLI 262..414 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.