DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and nhr-116

DIOPT Version :10

Sequence 1:NP_477140.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_507273.2 Gene:nhr-116 / 180129 WormBaseID:WBGene00003706 Length:448 Species:Caenorhabditis elegans


Alignment Length:79 Identity:31/79 - (39%)
Similarity:42/79 - (53%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRN---QCRACRL 74
            |.|||..:.|.||.:.||:||..||:|.....|.::||...|    | .|.|.|.   :||||||
 Worm    50 CLVCGRSAHGYHYNVASCNGCKTFFRRMCLSGRSFSCKLDRD----C-FDLTKRKTPAKCRACRL 109

  Fly    75 AKCFQSAMNKDAVQ 88
            .:|....|:..|::
 Worm   110 QRCLSVGMDPGAME 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_477140.1 NR_DBD_TLX 5..98 CDD:143537 31/79 (39%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
nhr-116NP_507273.2 ZnF_C4 50..119 CDD:197701 30/73 (41%)
HOLI 262..414 CDD:214658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.