DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and nr1h4

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_002936891.3 Gene:nr1h4 / 100489310 XenbaseID:XB-GENE-487942 Length:478 Species:Xenopus tropicalis


Alignment Length:78 Identity:37/78 - (47%)
Similarity:47/78 - (60%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GDRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQC 69
            ||.|    |.||||.:||.||...:|:||.|||:|||.:|.:|.||..|:    |.:|...|.:|
 Frog   128 GDEL----CVVCGDNASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGN----CEMDMYMRRKC 184

  Fly    70 RACRLAKCFQSAM 82
            :.|||.||.|..|
 Frog   185 QECRLRKCKQMGM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 37/78 (47%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
nr1h4XP_002936891.3 NR_DBD_FXR 129..212 CDD:143520 36/77 (47%)
NR_LBD 252..473 CDD:416257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.