DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and rarb

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_002932450.2 Gene:rarb / 100488600 XenbaseID:XB-GENE-481009 Length:447 Species:Xenopus tropicalis


Alignment Length:84 Identity:39/84 - (46%)
Similarity:60/84 - (71%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAK 76
            ||.||.|:|||.|||:.:|:||.|||:|||.:|.:|||..    :..|.::|..||:|:.|||.:
 Frog    80 PCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHR----EKNCVINKVTRNRCQYCRLQR 140

  Fly    77 CFQSAMNKDAVQHERGPRK 95
            ||:..|:|::|:::|..:|
 Frog   141 CFEVGMSKESVRNDRNKKK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 39/84 (46%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
rarbXP_002932450.2 NR_DBD_RAR 75..159 CDD:143522 38/82 (46%)
NR_LBD_RAR 179..409 CDD:132735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.