DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsf and nr1i2

DIOPT Version :9

Sequence 1:NP_001260109.1 Gene:dsf / 33823 FlyBaseID:FBgn0015381 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001091887.1 Gene:nr1i2 / 100038168 XenbaseID:XB-GENE-480112 Length:391 Species:Xenopus tropicalis


Alignment Length:121 Identity:40/121 - (33%)
Similarity:59/121 - (48%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCKATGDLKGRCPVDKTHRNQCRACRLAKC 77
            |:.||||::|.|:...:|:||.|||:|::.|....:|    ..:..|.::|::|..|:||||.||
 Frog    37 CRACGDRATGYHFNAMTCEGCKGFFRRAMKRKLQLSC----PFQNSCVINKSNRRHCQACRLKKC 97

  Fly    78 FQSAMNK------DAVQHERG--PRKPKL-----HP---QLHHHHHHAAAAAAAAH 117
            ....|.|      :||:..|.  .||.:|     .|   .|.....|.....|.||
 Frog    98 LDIGMRKELIMSDEAVEQRRALIKRKQRLAESPPEPPGTSLTPEQQHFVTELAGAH 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsfNP_001260109.1 NR_DBD_TLX 5..98 CDD:143537 33/92 (36%)
NR_LBD_Tlx_PNR_like 467..671 CDD:132748
nr1i2NP_001091887.1 NR_DBD_PXR 36..122 CDD:143536 31/88 (35%)
NR_LBD 138..385 CDD:299703 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.