DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14000 and CG14315

DIOPT Version :9

Sequence 1:NP_608969.1 Gene:CG14000 / 33820 FlyBaseID:FBgn0031749 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_650677.1 Gene:CG14315 / 42164 FlyBaseID:FBgn0038568 Length:217 Species:Drosophila melanogaster


Alignment Length:169 Identity:31/169 - (18%)
Similarity:71/169 - (42%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNQVWVFFKLIEVLLGSVCMFFHIRGSSY-------WPERTPHVIL---YCATFSSFTALAALGA 55
            |..|...|.::|.......:::.::...:       |.:    |::   |.:.|..||.:....:
  Fly     8 MRPVLFLFYMVETTANLFVLYYQLKAFVFVNLTTMKWED----VLIQSFYMSFFYIFTVVTLFAS 68

  Fly    56 FRLLLARSTVLSSQLLLTLSAVLSHYFCGVLIMRTAMLDPHLAFIN---STIEYLE---HPHFAH 114
            ..|.....|.:..:::..|...:.:....::.:..|..|.::.:..   ..:.|.|   ||.|..
  Fly    69 INLCTGHRTSIVEEVVRPLIGFVLYTVISLMALGDAETDFYIWYDGRNPDDLLYPEKPLHPFFGS 133

  Fly   115 CKQQSIAALVTGTMYLMHMFHVFDLLMRMEPGDWKRQAT 153
            .:.|:.|:||:..:||:|.....|:|:..:..|.:|:::
  Fly   134 LRDQATASLVSSVIYLLHCLIALDVLLSNDDSDNERESS 172



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR41152
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.