DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9021 and CG14963

DIOPT Version :9

Sequence 1:NP_001285647.1 Gene:CG9021 / 33818 FlyBaseID:FBgn0031747 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_647778.1 Gene:CG14963 / 38383 FlyBaseID:FBgn0035409 Length:261 Species:Drosophila melanogaster


Alignment Length:273 Identity:55/273 - (20%)
Similarity:99/273 - (36%) Gaps:93/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LPVWEEQEHVRFAREVTEKPVGTAATAENSTPKDTLDLVLQPKENKECPTNAERGLTNLVRVARP 130
            |.:|..|        :....||..|....:|        |.|      |....:.|..:.|    
  Fly    18 LALWSPQ--------LVPPTVGLLAPGPPAT--------LAP------PPTLSQDLEEIQR---- 56

  Fly   131 LLPAATLKNILANG-VEDPQVQELIKLLRSDNFKTQ----------VQLLKATKQHQLL-----H 179
            |:.:..|..:|... :.|.|.|..::::.|:...|.          :..|:.|.| |||     .
  Fly    57 LIQSKPLNQLLVRYLINDAQFQAFVRIINSNAAVTARWRLLSQPELILFLQWTDQ-QLLASGGSF 120

  Fly   180 DYVCRRLKLDPTYYAEYVRVFLDLHISDPPTIKLPNRRP-------GVRGLLQDLREALPRTALR 237
            :...:|||                       :.|.|:.|       |.:|.|.:::         
  Fly   121 ELEEQRLK-----------------------VSLLNQFPYWSGTVFGWQGFLNEVQ--------- 153

  Fly   238 NMYQQLYSSDSELSSAIRLIRG--SEFRRLLRDLRQL-------KEYRSLAADLEKSGVPLRQLQ 293
             :|..||:..:.:.:.: |.:|  ::|...|:.||.:       .|...:.|:|:|:|:...||.
  Fly   154 -LYFPLYAIRAHIDAKV-LQQGIFAQFWSRLQGLRVMYERWLTTVETTQVLAELQKAGIDTVQLD 216

  Fly   294 QLVANALGWSTVD 306
            .::...|||:.|:
  Fly   217 GIIRELLGWNAVN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9021NP_001285647.1 Ins_allergen_rp 120..293 CDD:284230 40/204 (20%)
CG14963NP_647778.1 Ins_allergen_rp 49..216 CDD:284230 40/205 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.