DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9021 and CG4409

DIOPT Version :9

Sequence 1:NP_001285647.1 Gene:CG9021 / 33818 FlyBaseID:FBgn0031747 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001097337.1 Gene:CG4409 / 36840 FlyBaseID:FBgn0034128 Length:276 Species:Drosophila melanogaster


Alignment Length:254 Identity:48/254 - (18%)
Similarity:99/254 - (38%) Gaps:61/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GTAATAENSTPKD----TLDLVLQPKENKECPTNAERGLTNLVRVARPLLPAATLKNILANGV-E 146
            |||  :|.|...|    :.||:...:: |..|.|....|:..|    .|:|...:::|.|:.. .
  Fly    47 GTA--SEESDESDQGNASDDLIFLSRQ-KPSPVNNSVDLSAFV----ALIPLQEVQSIAAHYYHH 104

  Fly   147 DPQVQELIKLLRSDNF---KTQVQLLKATKQHQLLHDYVCRRLKLDPTYY-----AEYVRVFLDL 203
            |.:.|.....|.|.:|   |.::..|...               |:.|.|     .:.|:|   :
  Fly   105 DAEFQRSYAFLASSDFADIKRKILQLPEV---------------LEFTNYLGNNGLDVVKV---M 151

  Fly   204 H---------------ISDPPTIKLP--------NRRPGVRGLLQDLREALPRTALRNMYQQLYS 245
            |               :::|..:...        ..:.|:.|:::.:.|.||:..|..::...:.
  Fly   152 HSVAGVFKPSILSSAAVNEPTKVTTTEDGSSAAGEAQTGLHGMVERVLEILPQDQLYALFFDEFE 216

  Fly   246 SDSELSSAIRLIRGSEFRRLLRDLRQLKEYRSLAADLEKSGVPLRQLQQLVANALGWST 304
            |:.:.::.:..|...:|.::|..|:.....|:|...|..:.:.:.::.:.|.:.|..|:
  Fly   217 SNKQFAAFVDSISSPKFAKILSGLQNSMPLRNLLFVLHNNSIYVERIVESVKSYLSISS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9021NP_001285647.1 Ins_allergen_rp 120..293 CDD:284230 34/204 (17%)
CG4409NP_001097337.1 Ins_allergen_rp 81..264 CDD:284230 34/204 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.