DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9021 and jtb

DIOPT Version :9

Sequence 1:NP_001285647.1 Gene:CG9021 / 33818 FlyBaseID:FBgn0031747 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_611126.1 Gene:jtb / 36838 FlyBaseID:FBgn0034126 Length:233 Species:Drosophila melanogaster


Alignment Length:189 Identity:34/189 - (17%)
Similarity:75/189 - (39%) Gaps:21/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LLPAATLKNILA-NGVEDPQVQELIKLLRSDNFKTQVQLLKATKQ--------------HQLLHD 180
            |:|..|:..::| :.:.|...::.||.|||.:|||..|.:::..:              .:.:..
  Fly    44 LIPTVTIDEVVAEHMITDSGFRKAIKFLRSSDFKTLQQRIESLPEVVDLINFVHLNDTTQETVEK 108

  Fly   181 YVCRRLKLDPTYYAEYVR--VFLDLHISDPPTIKLPNRRPGVRGLLQDLREALPRTALRNMYQQL 243
            |..|....:....:.|:|  :.|.|..|.....:|.:....||.:|..    |||.....:..:.
  Fly   109 YWYRNNTYNRLRRSAYLREQIVLVLLESSSEFTQLSSFTSFVREILTH----LPRDRFVALINEK 169

  Fly   244 YSSDSELSSAIRLIRGSEFRRLLRDLRQLKEYRSLAADLEKSGVPLRQLQQLVANALGW 302
            ....:..:...:.::.:||:.......:....:|:..:|.:..:..:.|:.:....:.|
  Fly   170 RQKSALFAKFYQALKSAEFKAKSEAAWKTSNVQSVVQELSRHAIDAQDLKTIGYEVISW 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9021NP_001285647.1 Ins_allergen_rp 120..293 CDD:284230 32/178 (18%)
jtbNP_611126.1 Ins_allergen_rp 33..219 CDD:284230 32/178 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.