DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrissinR and Ffar4

DIOPT Version :9

Sequence 1:NP_001097092.1 Gene:TrissinR / 33812 FlyBaseID:FBgn0085410 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001040553.1 Gene:Ffar4 / 294075 RGDID:1308252 Length:361 Species:Rattus norvegicus


Alignment Length:244 Identity:63/244 - (25%)
Similarity:103/244 - (42%) Gaps:44/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 DVRIIFITLYT----LVFCCCFFGNLLVILVVTLSRRLRSIT-----NFFLANLAFADFCVGLFC 237
            |.|::...|.|    |:|.....||:.. ||:.:.||.|..|     |.|.|:|.|.. .:.|..
  Rat    34 DHRLVLSVLETTVLGLIFVVSLLGNVCA-LVLVVRRRRRGATVSLVLNLFCADLLFTS-AIPLVL 96

  Fly   238 VMQNLSIYLIESWVFGEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPITCKQILTAARLR 302
            |::     ..|:|:.|..:|.:..:|.::|.:.:|..|..:.:||...||            |||
  Rat    97 VVR-----WTEAWLLGPVVCHLLFYVMTMSGSVTILTLAAVSLERMVCIV------------RLR 144

  Fly   303 ------------MVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMFNSKLLDMI 355
                        .::..:|..||:.:.|..:..:.:........||..||.||......::...:
  Rat   145 RGLSGPGRRTQAALLAFIWGYSALAALPLCILFRVVPQRLPGGDQEIPICTLDWPNRIGEISWDV 209

  Fly   356 NFVLL-YVMPLLVMTVLYSKIAIALWRSSRGLT---PHVVQHQHQQPQQ 400
            .||.| :::|.||:.:.||||......|.:.||   .:...||.:..||
  Rat   210 FFVTLNFLVPGLVIVISYSKILQITKASRKRLTLSLAYSESHQIRVSQQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrissinRNP_001097092.1 7tm_4 191..>327 CDD:304433 37/156 (24%)
7tm_1 201..>385 CDD:278431 51/201 (25%)
Ffar4NP_001040553.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
7tm_1 77..321 CDD:278431 49/200 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.