DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrissinR and Prokr1

DIOPT Version :9

Sequence 1:NP_001097092.1 Gene:TrissinR / 33812 FlyBaseID:FBgn0085410 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_620433.1 Gene:Prokr1 / 192648 RGDID:708443 Length:393 Species:Rattus norvegicus


Alignment Length:273 Identity:77/273 - (28%)
Similarity:126/273 - (46%) Gaps:54/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 GESTTSLVPALTTGLSG-DGSGA---------------VIEDEEDAEKASEYIFDRTDVRIIFIT 189
            ||:||:   ..|...|. |||||               :..|||:         |.|:.|..|..
  Rat     9 GENTTN---TFTDFFSARDGSGAETSPLPFTFSYGDYDMPSDEEE---------DVTNSRTFFAA 61

  Fly   190 LYTL------VFCCCFFGNLLVILVVTLSRRLRSITNFFLANLAFADFCVGLFCVMQNLSIYLIE 248
            ...:      :...|..||.:.|..:...::||::||..:||||.:||.|.:.|....:..|::.
  Rat    62 KIVIGMALVGIMLVCGIGNFIFITALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVR 126

  Fly   249 --SWVFGEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPI----TCKQILTAARLRMVIVT 307
              ||..|..||....::.::|...|...|:.|.::||.|||||:    .|:   |||.|   |..
  Rat   127 QLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQ---TAAGL---IFL 185

  Fly   308 VWITSAVYSTPKFVF-SKTIKNIHTQDGQEEEIC----VLDREMFNSKLLDMINFVLLYVMPLLV 367
            ||..|.:.:.|...| ::|:..|  .:.||:..|    .:|::.:..... ::.|.|.:|.|::.
  Rat   186 VWSVSILIAIPAAYFTTETVLVI--VESQEKIFCGQIWPVDQQFYYRSYF-LLVFGLEFVGPVIA 247

  Fly   368 MTVLYSKIAIALW 380
            ||:.|::::..||
  Rat   248 MTLCYARVSRELW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrissinRNP_001097092.1 7tm_4 191..>327 CDD:304433 45/148 (30%)
7tm_1 201..>385 CDD:278431 58/191 (30%)
Prokr1NP_620433.1 7tmA_prokineticin-R 63..353 CDD:320332 59/207 (29%)
TM helix 1 65..89 CDD:320332 4/23 (17%)
TM helix 2 98..120 CDD:320332 9/21 (43%)
TM helix 3 138..160 CDD:320332 4/21 (19%)
TM helix 4 181..197 CDD:320332 5/18 (28%)
TM helix 5 230..253 CDD:320332 6/23 (26%)
TM helix 6 283..305 CDD:320332
TM helix 7 321..346 CDD:320332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.