DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11034 and Dpp6

DIOPT Version :10

Sequence 1:NP_608961.2 Gene:CG11034 / 33810 FlyBaseID:FBgn0031741 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_997165.2 Gene:Dpp6 / 13483 MGIID:94921 Length:859 Species:Mus musculus


Alignment Length:104 Identity:25/104 - (24%)
Similarity:43/104 - (41%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KRDLHILSAGTAVYTSDERFQVIRS---DKAENWTLQIKFAQQRDSGIYECQVNTEPKMSMAFRL 100
            |.:..|.|.|..: |..||.::|.:   :|:....|..|:.::|.      |.|...|:.:|..|
Mouse   176 KIEKQIQSKGPGI-TERERREIIENAEKEKSPEQNLFEKYLERRG------QSNFLAKLYLARHL 233

  Fly   101 NVVEAKAIILGPTDLYVKMGSVVTLTCIISQGPHDLGTI 139
            .::...:|.:.....|.........||.:. ||.|..:|
Mouse   234 AIICLSSIPITYLSAYYARQRQNEFTCALG-GPPDTSSI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11034NP_608961.2 DPPIV_N 103..457 CDD:395744 8/37 (22%)
Peptidase_S9 538..745 CDD:459761
Dpp6NP_997165.2 DPPIV_N 189..555 CDD:395744 21/90 (23%)
Peptidase_S9 635..841 CDD:459761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.