DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7239 and msantd1

DIOPT Version :9

Sequence 1:NP_608960.2 Gene:CG7239 / 33809 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001314777.1 Gene:msantd1 / 798497 ZFINID:ZDB-GENE-121227-1 Length:274 Species:Danio rerio


Alignment Length:188 Identity:46/188 - (24%)
Similarity:68/188 - (36%) Gaps:36/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AEQDLGMCGGQELLDGRGKEKARRYWTPSEEERLYEIWGRDNWRLTRTGKNTIFFGRWAEELRDR 81
            |.:||  |....:.....|.:..|.||.||.:.|..||......|.:..:|...:...|::|.:.
Zfish     2 ASEDL--CFSYTVPGSNEKHRRARNWTDSEMKALVYIWEEYVTELKKAKRNAKIYETMAKQLYEL 64

  Fly    82 FAVDVKPEEIQMKVNQTRAKFRQVKKQLQADPSSYATRWKKYDIINRILKNL------------- 133
            .......|||:||:.....:||::|  ..|:..|....|..|..|.|||..:             
Zfish    65 TGEQRHREEIKMKITNMTFQFRKLK--YTANGGSSTPDWPYYKSIERILSKVPDHGHMSPPNLSS 127

  Fly   134 -------HRPKNADPLPPEALL-------NNRDMTPPRD-----DASAEQLQQQPQQQ 172
                   |.|......||...|       ..|||....|     .||:.:.:.||.::
Zfish   128 SGPSTSQHDPAVPQSAPPSGFLPEYTGSSEERDMNDEDDGLTDNSASSFETRSQPHKR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 23/84 (27%)
msantd1NP_001314777.1 Myb_DNA-bind_4 22..105 CDD:290549 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.