DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7239 and CG18766

DIOPT Version :9

Sequence 1:NP_608960.2 Gene:CG7239 / 33809 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster


Alignment Length:279 Identity:56/279 - (20%)
Similarity:103/279 - (36%) Gaps:69/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KARRYWTPSEEERLYEIWGRDNWRLTRTGKNTIFFGRWAEELRDRFAVDVKPEEIQMKVNQTRAK 101
            |.||.|..|....|.::|....:.|....:|...:...|::|.. ..|.|...|:..|||....:
  Fly     8 KKRRQWEDSGVLELIKLWKVCAYELRTIKRNGHLYVAMAKQLTS-LGVPVTALEVHFKVNNLTQR 71

  Fly   102 FRQVKKQLQADPSSYATRWKKYDIINRILKNL-----HRPK------NADPLP--PEALLNNRDM 153
            :||.:|..:.  :...:.||.|..::.:.|:|     ::.|      |...||  .|:.:....|
  Fly    72 YRQEQKTFET--TGIISTWKFYSQVDDVFKSLAAHTGYKDKRMTSASNTSSLPSTSESPVWKNPM 134

  Fly   154 TPPRDDAS----------------AEQLQQQPQQQSVQQQQQQGLGLASEPSTAT---------- 192
            :....:::                .:..|..|...||.........:|:..:.|:          
  Fly   135 SQQEFNSNNTEGFYKTEYGMHRHFMDHSQPPPNAGSVDNFMASSAAVAAVAAAASARLADNNMDQ 199

  Fly   193 YYNSSSNSNHGS-SHNNNTSGGVSFNTELFTDQYDEVVKQEYED------------DEYRSIP-- 242
            ..|:::..:.|| ....||:|||:        .|.: :|:.:||            |.::|.|  
  Fly   200 QMNTAAGGSGGSGGGGGNTNGGVA--------NYQK-IKKSHEDYDKFVDIVKNIVDTHKSTPDK 255

  Fly   243 ---FQEQLQQYSPAEPAQL 258
               |.:.::.|....|.:|
  Fly   256 VDTFGDFIKSYMKRWPERL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 21/84 (25%)
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.