DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7239 and Msantd1

DIOPT Version :9

Sequence 1:NP_608960.2 Gene:CG7239 / 33809 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001102559.1 Gene:Msantd1 / 498394 RGDID:1565796 Length:278 Species:Rattus norvegicus


Alignment Length:287 Identity:61/287 - (21%)
Similarity:106/287 - (36%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LNAGGSGSGAEQDLGMCGGQELLDGRGKEKARRYWTPSEEERLYEIWGRDNWRLTRTGKNTIFFG 72
            ||..|:.|.|..::   .|..:.....|.:..|.||.:|...|..:|......|.:|.:|...:.
  Rat    15 LNPAGASSMAAAEV---PGYLVSPQTEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYE 76

  Fly    73 RWAEELRDRFAVDVKPEEIQMKVNQTRAKFRQVKKQLQADPSSYATRWKKYDIINRILKNLHRPK 137
            :.|.:|.:........|||::|:.....::|::|  ...|..|....|..|..|:|||..:  |:
  Rat    77 KMASKLFEMTGERRLGEEIKIKITNMTFQYRKLK--CMTDSESVPPDWPYYLAIDRILAKV--PE 137

  Fly   138 NADPLPPEALLNNRDMTPPRDDASAEQLQQQPQQQSVQQQQQQGLGLASEPSTATYYNSSSNSNH 202
            :.:...|:.                    |||...:.|.:........|.|....|...|.....
  Rat   138 SCEGKLPDG--------------------QQPGPSTSQTEASLSPSAKSTPLYLPYTQCSYEGRF 182

  Fly   203 GSSHNNNTSG--GVSFNTELFTDQYDEVVKQEYEDDEYRSIPFQ-----------EQLQQYSPA- 253
            ....::::|.  .:.|.:|      :..||:.    :.||...|           |:.::.|.| 
  Rat   183 EDDRSDSSSSLLSLKFRSE------ERPVKKR----KMRSCHLQKKKLRLLEAMLEEQRRLSRAM 237

  Fly   254 -----EPAQLLELQTPQQQQQLQQQQQ 275
                 |..::|:.|...|.|.||.|::
  Rat   238 EETCREVRRVLDQQNILQVQSLQLQER 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 20/84 (24%)
Msantd1NP_001102559.1 Myb_DNA-bind_4 43..125 CDD:290549 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.