DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7239 and Msantd1

DIOPT Version :9

Sequence 1:NP_608960.2 Gene:CG7239 / 33809 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_997160.1 Gene:Msantd1 / 403174 MGIID:2684990 Length:278 Species:Mus musculus


Alignment Length:290 Identity:63/290 - (21%)
Similarity:108/290 - (37%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LNAGGSGSGAEQDLGMCGGQELLDGRGKEKARRYWTPSEEERLYEIWGRDNWRLTRTGKNTIFFG 72
            ||..|:.:.|..::   .|..:.....|.:..|.||.:|...|..:|......|.:|.:|...:.
Mouse    15 LNPAGASNMAAAEV---PGYLVSPQTEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYE 76

  Fly    73 RWAEELRDRFAVDVKPEEIQMKVNQTRAKFRQVKKQLQADPSSYATRWKKYDIINRILKNLHRPK 137
            :.|.:|.:........|||::|:.....::|::|  ...|..|....|..|..|:|||..:  |:
Mouse    77 KMASKLFEMTGERRLGEEIKIKITNMTFQYRKLK--CMTDSESIPPDWPYYLAIDRILAKV--PE 137

  Fly   138 NADPLPPEALLNNRDMTPPRDDASAEQLQQQPQQQSVQQQQQQGLGLASEPSTATY--YNSSSNS 200
            :.:...|:.                    |||...:.|.:....   .|..||..|  |...|..
Mouse   138 SCEGKLPDG--------------------QQPGPSTSQTEASLS---PSAKSTPLYLPYTQCSYE 179

  Fly   201 NHGSSHNNNTSG---GVSFNTELFTDQYDEVVKQEYEDDEYRSIPFQ-----------EQLQQYS 251
            .|.....:::|.   .:.|.:|      :..||:.    :.||...|           |:.::.|
Mouse   180 GHFEDDRSDSSSSLLSLKFRSE------ERPVKKR----KMRSCHLQKKKLRLLEAMLEEQRRLS 234

  Fly   252 PA------EPAQLLELQTPQQQQQLQQQQQ 275
            .|      |..::|:.|...|.|.||.|::
Mouse   235 RAMEETCREVRRVLDQQNILQVQSLQLQER 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 20/84 (24%)
Msantd1NP_997160.1 Myb_DNA-bind_4 43..125 CDD:290549 20/83 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 6/50 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.